EWSR1 (NM_005243) Human Recombinant Protein
Recombinant protein of human Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant EWS
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203709 protein sequence
Red=Cloning site Green=Tags(s) MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSY GQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQ DGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQ QNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQ ESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGPP VDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPP TAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRG GDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGG DRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGG RRGGRGGPGKMDKGEHRQERRDRPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 68.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | Transmission electron microscopy (PMID: 26286827) In vitro kinase assay inhibitor (PMID: 29513652) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005234 |
Locus ID | 2130 |
UniProt ID | Q01844 |
Cytogenetics | 22q12.2 |
Refseq Size | 2679 |
Refseq ORF | 1965 |
Synonyms | bK984G1.4; EWS; EWS-FLI1 |
Summary | This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401610 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431514 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432342 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401610 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 2 |
USD 436.00 |
|
LY431514 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 4 |
USD 436.00 |
|
LY432342 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 1 |
USD 436.00 |
|
PH303709 | EWSR1 MS Standard C13 and N15-labeled recombinant protein (NP_005234) |
USD 3,255.00 |