EWSR1 (NM_005243) Human Mass Spec Standard

SKU
PH303709
EWSR1 MS Standard C13 and N15-labeled recombinant protein (NP_005234)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203709]
Predicted MW 68.4 kDa
Protein Sequence
Protein Sequence
>RC203709 protein sequence
Red=Cloning site Green=Tags(s)

MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSY
GQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQ
DGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQ
QNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQ
ESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGPP
VDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPP
TAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRG
GDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGG
DRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGG
RRGGRGGPGKMDKGEHRQERRDRPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005234
RefSeq Size 2679
RefSeq ORF 1965
Synonyms bK984G1.4; EWS; EWS-FLI1
Locus ID 2130
UniProt ID Q01844
Cytogenetics 22q12.2
Summary This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009]
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Write Your Own Review
You're reviewing:EWSR1 (NM_005243) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401610 EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431514 EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432342 EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401610 Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 2 100 ug
$436.00
LY431514 Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 4 100 ug
$436.00
LY432342 Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 1 100 ug
$436.00
TP303709 Recombinant protein of human Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant EWS, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.