OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF213 (NM_004220) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303547
Recombinant protein of human zinc finger protein 213 (ZNF213), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA810393 ZNF213 mouse monoclonal antibody,clone OTI1H9 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ZNF213 or NM_004220"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203547 protein sequence
Red=Cloning site Green=Tags(s)

MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPHEAFSQLWELC
CRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALVEDLQKQPVKAWRQDVPSEEA
EPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFY
FSREEWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAW
ESENRPRAALGPVVGARRGRPPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPEC
DKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHR
RVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004211
Locus ID 7760
UniProt ID O14771
Cytogenetics 16p13.3
RefSeq Size 3301
RefSeq ORF 1377
Synonyms CR53; ZKSCAN21; ZSCAN53
Summary C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.supplied by OMIM, Apr 2004
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF213" proteins (5)
SKU Description Size Price
PH303547 ZNF213 MS Standard C13 and N15-labeled recombinant protein (NP_004211) 10 ug
$3,360.00
LC418147 Lyophilized ZNF213 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427465 Lyophilized ZNF213 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418147 Transient overexpression lysate of zinc finger protein 213 (ZNF213), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427465 Transient overexpression lysate of zinc finger protein 213 (ZNF213), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products