CDC42EP1 (NM_007061) Human Recombinant Protein

SKU
TP303483
Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203483 protein sequence
Red=Cloning site Green=Tags(s)

MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGS
SGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSF
DSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSEL
LGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCP
NGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEE
WRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_008992
Locus ID 11135
UniProt ID Q00587
Cytogenetics 22q13.1
RefSeq Size 2182
RefSeq ORF 1152
Synonyms 55 kDa bone marrow stromal/endothelial cell protein; BORG5; CDC42 effector protein (Rho GTPase binding) 1; CDC42 effector protein 1; CEP1; CEP1, BORG5, MSE55, MGC15316; MGC15316; MSE55; OTTHUMP00000028709; serum constituent protein
Summary CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CDC42EP1 (NM_007061) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303483 CDC42EP1 MS Standard C13 and N15-labeled recombinant protein (NP_008992) 10 ug
$3,255.00
LC407674 CDC42EP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416226 CDC42EP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407674 Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1) 100 ug
$436.00
LY416226 Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.