CDC42EP1 (NM_007061) Human Recombinant Protein

SKU TP303483

Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203483 protein sequence; Red=Cloning site Green=Tags(s); ; MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGS; SGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSF; DSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSEL; LGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCP; NGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEE; WRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_008992
• Locus ID: 11135
• UniProt ID: Q00587
• Cytogenetics: 22q13.1
• RefSeq Size: 2182
• RefSeq ORF: 1152
• Synonyms: 55 kDa bone marrow stromal/endothelial cell protein; BORG5; CDC42 effector protein (Rho GTPase binding) 1; CDC42 effector protein 1; CEP1; CEP1, BORG5, MSE55, MGC15316; MGC15316; MSE55; OTTHUMP00000028709; serum constituent protein
• Summary: CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. [provided by RefSeq, Jul 2008]