ARL3 (NM_004311) Human Recombinant Protein

SKU
TP303469
Recombinant protein of human ADP-ribosylation factor-like 3 (ARL3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203469 protein sequence
Red=Cloning site Green=Tags(s)

MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGG
QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIA
EGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004302
Locus ID 403
UniProt ID P36405
Cytogenetics 10q24.32
RefSeq Size 3891
RefSeq ORF 546
Synonyms ARFL3; JBTS35; RP83
Summary ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ARL3 (NM_004311) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303469 ARL3 MS Standard C13 and N15-labeled recombinant protein (NP_004302) 10 ug
$3,255.00
LC418068 ARL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418068 Transient overexpression lysate of ADP-ribosylation factor-like 3 (ARL3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.