Cyclophilin A (PPIA) (NM_021130) Human Recombinant Protein
SKU
TP303307
Recombinant protein of human peptidylprolyl isomerase A (cyclophilin A) (PPIA), 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC203307 protein sequence
Red=Cloning site Green=Tags(s) MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH NGTGGKSIYGEKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE AMERFGSRNGKTSKKITIADCGQLE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_066953 |
Locus ID | 5478 |
UniProt ID | P62937 |
Cytogenetics | 7p13 |
RefSeq Size | 2288 |
RefSeq ORF | 495 |
Synonyms | CYPA; CYPH; HEL-S-69p |
Summary | This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303307 | PPIA MS Standard C13 and N15-labeled recombinant protein (NP_066953) | 10 ug |
$3,255.00
|
|
LC402839 | PPIA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402839 | Transient overexpression lysate of peptidylprolyl isomerase A (cyclophilin A) (PPIA) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.