Cyclophilin A (PPIA) (NM_021130) Human Recombinant Protein

SKU
TP303307
Recombinant protein of human peptidylprolyl isomerase A (cyclophilin A) (PPIA), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203307 protein sequence
Red=Cloning site Green=Tags(s)

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH
NGTGGKSIYGEKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE
AMERFGSRNGKTSKKITIADCGQLE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_066953
Locus ID 5478
UniProt ID P62937
Cytogenetics 7p13
RefSeq Size 2288
RefSeq ORF 495
Synonyms CYPA; CYPH; HEL-S-69p
Summary This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Cyclophilin A (PPIA) (NM_021130) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303307 PPIA MS Standard C13 and N15-labeled recombinant protein (NP_066953) 10 ug
$3,255.00
LC402839 PPIA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402839 Transient overexpression lysate of peptidylprolyl isomerase A (cyclophilin A) (PPIA) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.