PFDN4 (NM_002623) Human Recombinant Protein

SKU
TP303137
Recombinant protein of human prefoldin subunit 4 (PFDN4), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203137 protein sequence
Red=Cloning site Green=Tags(s)

MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQ
IGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002614
Locus ID 5203
UniProt ID Q9NQP4
Cytogenetics 20q13.2
RefSeq Size 1383
RefSeq ORF 402
Synonyms C1; PFD4
Summary This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PFDN4 (NM_002623) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303137 PFDN4 MS Standard C13 and N15-labeled recombinant protein (NP_002614) 10 ug
$3,255.00
LC419198 PFDN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419198 Transient overexpression lysate of prefoldin subunit 4 (PFDN4) 100 ug
$436.00
TP720516 Recombinant protein of human prefoldin subunit 4 (PFDN4) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.