GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein

CAT#: TP303135

Reviews ()
Write a review

Recombinant protein of human prolactin-induced protein (PIP)



  View other "PIP" proteins (6)

USD 823.00


Availability*
In Stock

Size
    • 20 ug


Product images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC203135 protein sequence
Red=Cloning site Green=Tags(s)

MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT
YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI
EILKVE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.4 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity Cell treatment (PMID: 27837018)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002643
Locus ID 5304
UniProt ID P12273
Cytogenetics 7q34
Refseq Size 591
Refseq ORF 438
Synonyms GCDFP-15; GCDFP15; GPIP4
Protein Families Secreted Protein

Documents

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 385.00


PIP mouse monoclonal antibody,clone OTI5E6
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.