GCDFP 15 (PIP) (NM_002652) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
| Product Data | |
| Tag | C-Myc/DDK |
|---|---|
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | [RC203135] |
| Predicted MW | 16.6 kDa |
| Protein Sequence |
Protein Sequence
>RC203135 protein sequence
Red=Cloning site Green=Tags(s) MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI EILKVE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
| Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Shipping | Dry Ice |
| Reference Data | |
| RefSeq | NP_002643 |
| RefSeq Size | 591 |
| RefSeq ORF | 438 |
| Synonyms | GCDFP-15; GCDFP15; GPIP4 |
| Locus ID | 5304 |
| UniProt ID | P12273 |
| Cytogenetics | 7q34 |
| Protein Families | Secreted Protein |
Write Your Own Review
| FAQs |
| SDS |
| Recombinant Protein Resources |
| SKU | Description | Size | Price | |
|---|---|---|---|---|
| LC419186 | PIP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
| LY419186 | Transient overexpression lysate of prolactin-induced protein (PIP) | 100 ug |
$436.00
|
|
| TP303135 | Recombinant protein of human prolactin-induced protein (PIP), 20 µg | 20 ug |
$737.00
|
|
| TP701042 | Purified recombinant protein of Human prolactin-induced protein (PIP), Gln29-End, with C-terminal His tag, expressed in HEK293 cells, 50ug | 50 ug |
$867.00
|
|
| TP710252 | Purified recombinant protein of Human prolactin-induced protein (PIP), residues aa29–end, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
| TP762416 | Purified recombinant protein of Human prolactin-induced protein (PIP), Gln29-End, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
Related Products
Check items to add to the cart or
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.