UBC6e (UBE2J1) (NM_016021) Human Recombinant Protein

SKU TP302826M

Recombinant protein of human ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) (UBE2J1), 100 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202826 representing NM_016021; Red=Cloning site Green=Tags(s); ; METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPM; KPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRAL; AKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDL; QDDIPTTFQGATASTSYGVQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDN; HTDHGGSAVLIVILTLALAALIFRRIYLANEYIFDFEL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057105
• Locus ID: 51465
• UniProt ID: Q9Y385
• Cytogenetics: 6q15
• RefSeq Size: 4360
• RefSeq ORF: 954
• Synonyms: CGI-76; HSPC153; HSPC205; HSU93243; NCUBE-1; NCUBE1; UBC6; UBC6E; Ubc6p
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Parkinson's disease, Ubiquitin mediated proteolysis