LXN (NM_020169) Human Recombinant Protein

SKU
TP302769
Recombinant protein of human latexin (LXN), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202769 protein sequence
Red=Cloning site Green=Tags(s)

MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNC
TAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLA
WVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVK
HNSRLPKEVQLE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064554
Locus ID 56925
UniProt ID Q9BS40
Cytogenetics 3q25.32
RefSeq Size 1132
RefSeq ORF 666
Synonyms ECI; TCI
Summary This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. The encoded protein, latexin, downregulates the population size of hematopoietic stem cells. This protein is found to be downregulated in cancer cells because of promoter hypermethylation. [provided by RefSeq, Jul 2020]
Write Your Own Review
You're reviewing:LXN (NM_020169) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302769 LXN MS Standard C13 and N15-labeled recombinant protein (NP_064554) 10 ug
$3,255.00
LC412596 LXN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412596 Transient overexpression lysate of latexin (LXN) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.