CRSP9 (MED7) (NM_004270) Human Recombinant Protein

SKU
TP302696
Recombinant protein of human mediator complex subunit 7 (MED7), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202696 representing NM_004270
Red=Cloning site Green=Tags(s)

MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPM
QFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMME
VQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGH
RRDQIIEKDAALCVLIDEMNERP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004261
Locus ID 9443
UniProt ID O43513
Cytogenetics 5q33.3
RefSeq Size 1066
RefSeq ORF 699
Synonyms ARC34; CRSP9; CRSP33
Summary The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:CRSP9 (MED7) (NM_004270) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302696 MED7 MS Standard C13 and N15-labeled recombinant protein (NP_004261) 10 ug
$3,255.00
LC418057 MED7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420292 MED7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418057 Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 2 100 ug
$436.00
LY420292 Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 1 100 ug
$436.00
TP761746 Purified recombinant protein of Human mediator complex subunit 7 (MED7), transcript variant 1, full length, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.