HAX1 (NM_006118) Human Recombinant Protein

SKU
TP302690
Recombinant protein of human HCLS1 associated protein X-1 (HAX1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202690 protein sequence
Red=Cloning site Green=Tags(s)

MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPG
GGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRI
FGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKS
ISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006109
Locus ID 10456
UniProt ID O00165
Cytogenetics 1q21.3
RefSeq Size 1196
RefSeq ORF 837
Synonyms HCLSBP1; HS1BP1; SCN3
Summary The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HAX1 (NM_006118) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302690 HAX1 MS Standard C13 and N15-labeled recombinant protein (NP_006109) 10 ug
$3,255.00
LC401845 HAX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422672 HAX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401845 Transient overexpression lysate of HCLS1 associated protein X-1 (HAX1), transcript variant 1 100 ug
$436.00
LY422672 Transient overexpression lysate of HCLS1 associated protein X-1 (HAX1), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.