MED4 (NM_014166) Human Recombinant Protein

SKU TP302663L

Recombinant protein of human mediator complex subunit 4 (MED4), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202663 protein sequence; Red=Cloning site Green=Tags(s); ; MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLI; HRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARK; GAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG; RLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_054885
• Locus ID: 29079
• UniProt ID: Q9NPJ6
• Cytogenetics: 13q14.2
• RefSeq Size: 2287
• RefSeq ORF: 810
• Synonyms: ARC36; DRIP36; HSPC126; TRAP36; VDRIP
• Summary: This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
• Protein Families: Druggable Genome, Transcription Factors