RPRM (NM_019845) Human Recombinant Protein

SKU TP302634L

Recombinant protein of human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202634 protein sequence; Red=Cloning site Green=Tags(s); ; MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV; FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_062819
• Locus ID: 56475
• UniProt ID: Q9NS64
• Cytogenetics: 2q23.3
• RefSeq Size: 1496
• RefSeq ORF: 327
• Synonyms: REPRIMO
• Summary: May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: p53 signaling pathway