EIF1AD (NM_032325) Human Recombinant Protein

SKU
TP302605
Recombinant protein of human eukaryotic translation initiation factor 1A domain containing (EIF1AD), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202605 protein sequence
Red=Cloning site Green=Tags(s)

MSQATKRKHVVKEVLGEHIVPSNQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLI
VDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDD
SDLFVNTNRRQYHESEEESEEEEAA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115701
Locus ID 84285
UniProt ID Q8N9N8
Cytogenetics 11q13.1
RefSeq Size 2896
RefSeq ORF 495
Synonyms haponin; OBELIX
Summary Plays a role into cellular response to oxidative stress. Decreases cell proliferation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EIF1AD (NM_032325) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302605 EIF1AD MS Standard C13 and N15-labeled recombinant protein (NP_115701) 10 ug
$3,255.00
LC410201 EIF1AD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410201 Transient overexpression lysate of eukaryotic translation initiation factor 1A domain containing (EIF1AD) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.