NME4 (NM_005009) Human Recombinant Protein

SKU
TP302603
Recombinant protein of human non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202603 protein sequence
Red=Cloning site Green=Tags(s)

MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG
MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD
FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005000
Locus ID 4833
UniProt ID O00746
Cytogenetics 16p13.3
RefSeq Size 1059
RefSeq ORF 561
Synonyms NDPK-D; nm23-H4; NM23H4
Summary The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Purine metabolism, Pyrimidine metabolism
Write Your Own Review
You're reviewing:NME4 (NM_005009) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302603 NME4 MS Standard C13 and N15-labeled recombinant protein (NP_005000) 10 ug
$3,255.00
LC401559 NME4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401559 Transient overexpression lysate of non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.