CAMKV (NM_024046) Human Recombinant Protein

SKU
TP302441
Recombinant protein of human CaM kinase-like vesicle-associated (CAMKV), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202441 protein sequence
Red=Cloning site Green=Tags(s)

MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHTCKKFQKRDGRKVRKAAKNE
IGILKMVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSERDTSNVVRQVLEAVAYLHSLK
IVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENGLIKEPCGTPEYLAPEVVGRQRYGRPVDCWAIGVIM
YILLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEA
ISHEWISGNAASDKNIKDGVCAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGA
AGGATAAAASGATSAPEGDAARAAKSDNVAPADRSATPATDGSATPATDGSVTPATDGSITPATDGSVTP
ATDRSATPATDGRATPATEESTVPTTQSSAMLATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAG
YAQESQREEAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076951
Locus ID 79012
UniProt ID Q8NCB2
Cytogenetics 3p21.31
RefSeq Size 3028
RefSeq ORF 1503
Synonyms 1G5; VACAMKL
Summary Does not appear to have detectable kinase activity.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:CAMKV (NM_024046) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302441 CAMKV MS Standard C13 and N15-labeled recombinant protein (NP_076951) 10 ug
$3,255.00
LC411422 CAMKV HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411422 Transient overexpression lysate of CaM kinase-like vesicle-associated (CAMKV) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.