Profilin 1 (PFN1) (NM_005022) Human Recombinant Protein

SKU
TP302338
Recombinant protein of human profilin 1 (PFN1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202338 protein sequence
Red=Cloning site Green=Tags(s)

MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK
CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Pull-down assay (PMID: 27991922)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005013
Locus ID 5216
UniProt ID P07737
Cytogenetics 17p13.2
RefSeq Size 1365
RefSeq ORF 420
Synonyms ALS18
Summary This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012]
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:Profilin 1 (PFN1) (NM_005022) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302338 PFN1 MS Standard C13 and N15-labeled recombinant protein (NP_005013) 10 ug
$3,255.00
LC417584 PFN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417584 Transient overexpression lysate of profilin 1 (PFN1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.