Profilin 1 (PFN1) (NM_005022) Human Recombinant Protein

CAT#: TP302338

Recombinant protein of human profilin 1 (PFN1), 20 µg

Product Images

Coomassie blue staining of purified PFN1 protein (Cat# TP302338). The protein was produced from HEK293T cells transfected with PFN1 cDNA clone (Cat# RC202338) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202338 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK
  CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: Pull-down assay (PMID: 27991922)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005013
• Locus ID: 5216
• UniProt ID: P07737
• Cytogenetics: 17p13.2
• Refseq Size: 1365
• Refseq ORF: 420
• Synonyms: ALS18
• Summary: This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012]
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Regulation of actin cytoskeleton