Profilin 1 (PFN1) (NM_005022) Human Mass Spec Standard

SKU PH302338

PFN1 MS Standard C13 and N15-labeled recombinant protein (NP_005013)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202338]
• Predicted MW: 15.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC202338 protein sequence; Red=Cloning site Green=Tags(s); ; MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQK; CSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005013
• RefSeq Size: 1365
• RefSeq ORF: 420
• Synonyms: ALS18
• Locus ID: 5216
• UniProt ID: P07737
• Cytogenetics: 17p13.2
• Summary: This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. [provided by RefSeq, Jul 2012]
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Regulation of actin cytoskeleton