MED30 (NM_080651) Human Recombinant Protein

SKU TP302305L

Recombinant protein of human mediator complex subunit 30 (MED30), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202305 protein sequence; Red=Cloning site Green=Tags(s); ; MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGT; YQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERR; EIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_542382
• Locus ID: 90390
• UniProt ID: Q96HR3
• Cytogenetics: 8q24.11
• RefSeq Size: 994
• RefSeq ORF: 534
• Synonyms: MED30S; THRAP6; TRAP25
• Summary: The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. MED30 is a component of this complex that appears to be metazoan specific (Baek et al., 2002 [PubMed 11909976]).[supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome, Transcription Factors