Apoptosis enhancing nuclease (AEN) (NM_022767) Human Recombinant Protein

SKU
TP302285
Recombinant protein of human apoptosis enhancing nuclease (AEN), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202285 protein sequence
Red=Cloning site Green=Tags(s)

MVPREAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGA
ATATEAASSGKQCLRAGSGSAPCSRRPAPGKASGPLPSKCVAIDCEMVGTGPRGRVSELARCSIVSYHGD
VLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQ
TRDTTYVPNFLSEPGLHTRARVSLKDLALQLLHKKIQVGQHGHSSVEDATTAMELYRLVEVQWEQQEARS
LWTCPEDREPDSSTDMEQYMEDQYWPDDLAHGSRGGAREAQDRRN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_073604
Locus ID 64782
UniProt ID Q8WTP8
Cytogenetics 15q26.1
RefSeq Size 3134
RefSeq ORF 975
Synonyms ISG20L1; pp12744
Summary Exonuclease with activity against single- and double-stranded DNA and RNA. Mediates p53-induced apoptosis. When induced by p53 following DNA damage, digests double-stranded DNA to form single-stranded DNA and amplifies DNA damage signals, leading to enhancement of apoptosis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Apoptosis enhancing nuclease (AEN) (NM_022767) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302285 AEN MS Standard C13 and N15-labeled recombinant protein (NP_073604) 10 ug
$3,255.00
LC402942 AEN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402942 Transient overexpression lysate of apoptosis enhancing nuclease (AEN) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.