Endothelin 1 (EDN1) (NM_001955) Human Recombinant Protein

SKU
TP302217
Recombinant protein of human endothelin 1 (EDN1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202217 protein sequence
Red=Cloning site Green=Tags(s)

MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD
IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN
NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRA
HW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001946
Locus ID 1906
UniProt ID P05305
Cytogenetics 6p24.1
RefSeq Size 2112
RefSeq ORF 636
Synonyms ARCND3; ET1; HDLCQ7; PPET1; QME
Summary This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Melanogenesis
Write Your Own Review
You're reviewing:Endothelin 1 (EDN1) (NM_001955) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302217 EDN1 MS Standard C13 and N15-labeled recombinant protein (NP_001946) 10 ug
$3,255.00
LC400720 EDN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432690 EDN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400720 Transient overexpression lysate of endothelin 1 (EDN1), transcript variant 1 100 ug
$436.00
LY432690 Transient overexpression lysate of endothelin 1 (EDN1), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.