UDP glucose dehydrogenase (UGDH) (NM_003359) Human Recombinant Protein

SKU
TP302132
Recombinant protein of human UDP-glucose dehydrogenase (UGDH), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202132 protein sequence
Red=Cloning site Green=Tags(s)

MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLF
FSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESI
RRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILT
TNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKD
VLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSS
IYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF
KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNK
KPKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003350
Locus ID 7358
UniProt ID O60701
Cytogenetics 4p14
RefSeq Size 3195
RefSeq ORF 1482
Synonyms DEE84; EIEE84; GDH; UDP-GlcDH; UDPGDH; UGD
Summary The protein encoded by this gene converts UDP-glucose to UDP-glucuronate and thereby participates in the biosynthesis of glycosaminoglycans such as hyaluronan, chondroitin sulfate, and heparan sulfate. These glycosylated compounds are common components of the extracellular matrix and likely play roles in signal transduction, cell migration, and cancer growth and metastasis. The expression of this gene is up-regulated by transforming growth factor beta and down-regulated by hypoxia. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]
Protein Pathways Amino sugar and nucleotide sugar metabolism, Ascorbate and aldarate metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Starch and sucrose metabolism
Write Your Own Review
You're reviewing:UDP glucose dehydrogenase (UGDH) (NM_003359) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302132 UGDH MS Standard C13 and N15-labeled recombinant protein (NP_003350) 10 ug
$3,255.00
LC401149 UGDH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433062 UGDH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401149 Transient overexpression lysate of UDP-glucose dehydrogenase (UGDH) 100 ug
$436.00
LY433062 Transient overexpression lysate of UDP-glucose 6-dehydrogenase (UGDH), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.