NIP7 (NM_016101) Human Recombinant Protein

SKU
TP302103
Recombinant protein of human nuclear import 7 homolog (S. cerevisiae) (NIP7), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202103 protein sequence
Red=Cloning site Green=Tags(s)

MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCF
GKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIP
LGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 20.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057185
Locus ID 51388
UniProt ID Q9Y221
Cytogenetics 16q22.1
RefSeq Size 2328
RefSeq ORF 540
Synonyms CGI-37; HSPC031; KD93
Summary Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NIP7 (NM_016101) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302103 NIP7 MS Standard C13 and N15-labeled recombinant protein (NP_057185) 10 ug
$3,255.00
LC414162 NIP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414162 Transient overexpression lysate of nuclear import 7 homolog (S. cerevisiae) (NIP7) 100 ug
$436.00
TP720548 Recombinant protein of human nuclear import 7 homolog (S. cerevisiae) (NIP7) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.