CHN 1 (CHN1) (NM_001025201) Human Recombinant Protein

SKU
TP302095
Recombinant protein of human chimerin (chimaerin) 1 (CHN1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202095 protein sequence
Red=Cloning site Green=Tags(s)

MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAADQLLIVAEGSY
LIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTIN
PIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHNFKV
HTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTK
RPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDL
PIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI
VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 49.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001020372
Locus ID 1123
UniProt ID P15882
Cytogenetics 2q31.1
RefSeq Size 2446
RefSeq ORF 1377
Synonyms ARHGAP2; CHN; DURS2; NC; RHOGAP2
Summary This gene encodes GTPase-activating protein for ras-related p21-rac and a phorbol ester receptor. It is predominantly expressed in neurons, and plays an important role in neuronal signal-transduction mechanisms. Mutations in this gene are associated with Duane's retraction syndrome 2 (DURS2). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Apr 2011]
Write Your Own Review
You're reviewing:CHN 1 (CHN1) (NM_001025201) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302095 CHN1 MS Standard C13 and N15-labeled recombinant protein (NP_001020372) 10 ug
$3,255.00
PH322163 CHN1 MS Standard C13 and N15-labeled recombinant protein (NP_001813) 10 ug
$3,255.00
LC400688 CHN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422480 CHN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400688 Transient overexpression lysate of chimerin (chimaerin) 1 (CHN1), transcript variant 1 100 ug
$436.00
LY422480 Transient overexpression lysate of chimerin (chimaerin) 1 (CHN1), transcript variant 2 100 ug
$436.00
TP322163 Recombinant protein of human chimerin (chimaerin) 1 (CHN1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.