RALB (NM_002881) Human Recombinant Protein
CAT#: TP301982
Recombinant protein of human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201982 protein sequence
Red=Cloning site Green=Tags(s) MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002872 |
Locus ID | 5899 |
UniProt ID | P11234, A0A024RAG3 |
Cytogenetics | 2q14.2 |
Refseq Size | 2275 |
Refseq ORF | 618 |
Summary | This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Pancreatic cancer, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419049 | RALB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419049 | Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB) |
USD 436.00 |
|
PH301982 | RALB MS Standard C13 and N15-labeled recombinant protein (NP_002872) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review