OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RALB (NM_002881) Human Mass Spec Standard

Be the first to review this product
SKU
PH301982
RALB MS Standard C13 and N15-labeled recombinant protein (NP_002872)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505880 RALB mouse monoclonal antibody, clone OTI2C4 (formerly 2C4) 100 ul
$447.00
LY419049 Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB) (as WB positive control) 100 ug
$436.00

Other products for "RALB or NM_002881"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201982
Predicted MW 23.4 kDa
Protein Sequence
Protein Sequence
>RC201982 protein sequence
Red=Cloning site Green=Tags(s)

MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPV
EEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002872
RefSeq Size 2275
RefSeq ORF 618
Locus ID 5899
UniProt ID P11234
Cytogenetics 2q14.2
Summary This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Pancreatic cancer, Pathways in cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RALB" proteins (3)
SKU Description Size Price
LC419049 Lyophilized RALB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419049 Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB) (as WB positive control) 100 ug
$436.00
TP301982 Recombinant protein of human v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) (RALB), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products