ZNRD2 (NM_006396) Human Recombinant Protein

SKU
TP301946
Recombinant protein of human Sjogren syndrome/scleroderma autoantigen 1 (SSSCA1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201946 protein sequence
Red=Cloning site Green=Tags(s)

MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYC
VACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPA
PAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006387
Locus ID 10534
UniProt ID O60232
Cytogenetics 11q13.1
RefSeq Size 661
RefSeq ORF 597
Synonyms p27; SSSCA1
Summary This antigen is recognized by a subset of anti-centromere antibodies from patients with scleroderma and/or Sjogren's syndrome. Subcellular localization has not yet been established. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ZNRD2 (NM_006396) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301946 SSSCA1 MS Standard C13 and N15-labeled recombinant protein (NP_006387) 10 ug
$3,255.00
LC416665 SSSCA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416665 Transient overexpression lysate of Sjogren syndrome/scleroderma autoantigen 1 (SSSCA1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.