SNRP70 (SNRNP70) (NM_003089) Human Recombinant Protein

SKU
TP301713
Recombinant protein of human small nuclear ribonucleoprotein 70kDa (U1) (SNRNP70), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201713 protein sequence
Red=Cloning site Green=Tags(s)

MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK
RREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS
GKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRH
SGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRER
SKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR
DRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG
DGYLAPENGYLMEAAPE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003080
Locus ID 6625
UniProt ID P08621
Cytogenetics 19q13.33
RefSeq Size 2008
RefSeq ORF 1311
Synonyms RNPU1Z; RPU1; Snp1; SNRP70; U1-70K; U1AP; U1RNP; U170K
Summary Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome (PubMed:19325628, PubMed:25555158). SNRNP70 binds to the loop I region of U1-snRNA (PubMed:2467746, PubMed:19325628, PubMed:25555158).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:SNRP70 (SNRNP70) (NM_003089) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301713 SNRNP70 MS Standard C13 and N15-labeled recombinant protein (NP_003080) 10 ug
$3,255.00
LC401077 SNRNP70 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401077 Transient overexpression lysate of small nuclear ribonucleoprotein 70kDa (U1) (SNRNP70) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.