Thioredoxin 2 (TXN2) (NM_012473) Human Recombinant Protein

SKU TP301666

Recombinant protein of human thioredoxin 2 (TXN2), nuclear gene encoding mitochondrial protein, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201666 protein sequence; Red=Cloning site Green=Tags(s); ; MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDF; QDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMK; NGDVVDKFVGIKDEDQLEAFLKKLIG; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_036605
• Locus ID: 25828
• UniProt ID: Q99757
• Cytogenetics: 22q12.3
• RefSeq Size: 1342
• RefSeq ORF: 498
• Synonyms: COXPD29; MT-TRX; MTRX; TRX2; TXN
• Summary: This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome