p27 KIP 1 (CDKN1B) (NM_004064) Human Recombinant Protein

SKU TP301661

Recombinant protein of human cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201661 representing NM_004064; Red=Cloning site Green=Tags(s); ; MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL; EGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDS; QTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004055
• Locus ID: 1027
• UniProt ID: P46527
• Cytogenetics: 12p13.1
• RefSeq Size: 2422
• RefSeq ORF: 594
• Synonyms: CDKN4; KIP1; MEN1B; MEN4; P27KIP1
• Summary: This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). [provided by RefSeq, Apr 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Chronic myeloid leukemia, ErbB signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer