Lysosomal acid lipase (LIPA) (NM_000235) Human Recombinant Protein

SKU
TP301637
Recombinant protein of human lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201637 protein sequence
Red=Cloning site Green=Tags(s)

MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGR
KNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFW
AFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCT
SPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVY
TTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADV
YDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000226
Locus ID 3988
UniProt ID P38571
Cytogenetics 10q23.31
RefSeq Size 2775
RefSeq ORF 1197
Synonyms CESD; LAL
Summary This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014]
Protein Families Druggable Genome
Protein Pathways Lysosome, Steroid biosynthesis
Write Your Own Review
You're reviewing:Lysosomal acid lipase (LIPA) (NM_000235) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301637 LIPA MS Standard C13 and N15-labeled recombinant protein (NP_000226) 10 ug
$3,255.00
LC424848 LIPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426820 LIPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424848 Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2 100 ug
$436.00
LY426820 Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.