Lysosomal acid lipase (LIPA) (NM_000235) Human Mass Spec Standard

SKU
PH301637
LIPA MS Standard C13 and N15-labeled recombinant protein (NP_000226)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201637]
Predicted MW 45.4 kDa
Protein Sequence
Protein Sequence
>RC201637 protein sequence
Red=Cloning site Green=Tags(s)

MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGR
KNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFW
AFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCT
SPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVY
TTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADV
YDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000226
RefSeq Size 2775
RefSeq ORF 1197
Synonyms CESD; LAL
Locus ID 3988
UniProt ID P38571
Cytogenetics 10q23.31
Summary This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014]
Protein Families Druggable Genome
Protein Pathways Lysosome, Steroid biosynthesis
Write Your Own Review
You're reviewing:Lysosomal acid lipase (LIPA) (NM_000235) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424848 LIPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426820 LIPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424848 Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2 100 ug
$436.00
LY426820 Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 1 100 ug
$436.00
TP301637 Recombinant protein of human lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.