Lysosomal acid lipase (LIPA) (NM_000235) Human Mass Spec Standard
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201637] |
Predicted MW | 45.4 kDa |
Protein Sequence |
Protein Sequence
>RC201637 protein sequence
Red=Cloning site Green=Tags(s) MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGR KNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFW AFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCT SPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVY TTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADV YDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_000226 |
RefSeq Size | 2775 |
RefSeq ORF | 1197 |
Synonyms | CESD; LAL |
Locus ID | 3988 |
UniProt ID | P38571 |
Cytogenetics | 10q23.31 |
Summary | This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome, Steroid biosynthesis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC424848 | LIPA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426820 | LIPA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY424848 | Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2 | 100 ug |
$436.00
|
|
LY426820 | Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 1 | 100 ug |
$436.00
|
|
TP301637 | Recombinant protein of human lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.