Annexin A3 (ANXA3) (NM_005139) Human Recombinant Protein
CAT#: TP301540
Recombinant protein of human annexin A3 (ANXA3), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201540 protein sequence
Red=Cloning site Green=Tags(s) MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005130 |
Locus ID | 306 |
UniProt ID | P12429 |
Cytogenetics | 4q21.21 |
Refseq Size | 1634 |
Refseq ORF | 969 |
Synonyms | ANX3 |
Summary | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417500 | ANXA3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417500 | Transient overexpression lysate of annexin A3 (ANXA3) |
USD 436.00 |
|
PH301540 | ANXA3 MS Standard C13 and N15-labeled recombinant protein (NP_005130) |
USD 3,255.00 |
|
TP721189 | Purified recombinant protein of Human annexin A3 (ANXA3) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review