Annexin A3 (ANXA3) (NM_005139) Human Mass Spec Standard

SKU
PH301540
ANXA3 MS Standard C13 and N15-labeled recombinant protein (NP_005130)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201540]
Predicted MW 36.4 kDa
Protein Sequence
Protein Sequence
>RC201540 protein sequence
Red=Cloning site Green=Tags(s)

MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD
DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL
GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK
LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS
EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005130
RefSeq Size 1634
RefSeq ORF 969
Synonyms ANX3
Locus ID 306
UniProt ID P12429
Cytogenetics 4q21.21
Summary This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008]
Protein Families Stem cell - Pluripotency
Write Your Own Review
You're reviewing:Annexin A3 (ANXA3) (NM_005139) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417500 ANXA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417500 Transient overexpression lysate of annexin A3 (ANXA3) 100 ug
$436.00
TP301540 Recombinant protein of human annexin A3 (ANXA3), 20 µg 20 ug
$737.00
TP721189 Purified recombinant protein of Human annexin A3 (ANXA3) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.