MCPIP1 (ZC3H12A) (NM_025079) Human Recombinant Protein

CAT#: TP301381

Recombinant protein of human zinc finger CCCH-type containing 12A (ZC3H12A)

Size: 20 ug 100 ug 1 mg



  View other "ZC3H12A" proteins (3)

USD 867.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal ZC3H12A Antibody
    • 100 ug

USD 528.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "ZC3H12A"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201381 representing NM_025079
Red=Cloning site Green=Tags(s)

MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQ
KLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVI
DGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVF
TPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDP
LGRHGPSLDNFLRKKPLTLEHRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPS
KDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRA
MGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRADSLAKEQASVYTKL
CGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 65.5 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Applications Cell culture: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079355
Locus ID 80149
UniProt ID Q5D1E8
Cytogenetics 1p34.3
Refseq Size 2697
Refseq ORF 1797
Synonyms dJ423B22.1; MCPIP; MCPIP-1; MCPIP1; Reg1
Summary ZC3H12A is an MCP1 (CCL2; MIM 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[supplied by OMIM, Mar 2008]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.