MCPIP1 (ZC3H12A) (NM_025079) Human Recombinant Protein

SKU
TP301381
Recombinant protein of human zinc finger CCCH-type containing 12A (ZC3H12A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201381 representing NM_025079
Red=Cloning site Green=Tags(s)

MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQ
KLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVI
DGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVF
TPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDP
LGRHGPSLDNFLRKKPLTLEHRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPS
KDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRA
MGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRADSLAKEQASVYTKL
CGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 65.5 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079355
Locus ID 80149
UniProt ID Q5D1E8
Cytogenetics 1p34.3
RefSeq Size 2697
RefSeq ORF 1797
Synonyms dJ423B22.1; MCPIP; MCPIP-1; MCPIP1; Reg1
Summary ZC3H12A is an MCP1 (CCL2; MIM 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:MCPIP1 (ZC3H12A) (NM_025079) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301381 ZC3H12A MS Standard C13 and N15-labeled recombinant protein (NP_079355) 10 ug
$3,255.00
LC410904 ZC3H12A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410904 Transient overexpression lysate of zinc finger CCCH-type containing 12A (ZC3H12A) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.