MCPIP1 (ZC3H12A) (NM_025079) Human Mass Spec Standard

SKU
PH301381
ZC3H12A MS Standard C13 and N15-labeled recombinant protein (NP_079355)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201381]
Predicted MW 65.5 kDa
Protein Sequence
Protein Sequence
>RC201381 representing NM_025079
Red=Cloning site Green=Tags(s)

MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQ
KLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVI
DGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVF
TPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDP
LGRHGPSLDNFLRKKPLTLEHRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPS
KDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRA
MGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRADSLAKEQASVYTKL
CGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079355
RefSeq Size 2697
RefSeq ORF 1797
Synonyms dJ423B22.1; MCPIP; MCPIP-1; MCPIP1; Reg1
Locus ID 80149
UniProt ID Q5D1E8
Cytogenetics 1p34.3
Summary ZC3H12A is an MCP1 (CCL2; MIM 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:MCPIP1 (ZC3H12A) (NM_025079) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410904 ZC3H12A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410904 Transient overexpression lysate of zinc finger CCCH-type containing 12A (ZC3H12A) 100 ug
$436.00
TP301381 Recombinant protein of human zinc finger CCCH-type containing 12A (ZC3H12A), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.