NSE (ENO2) (NM_001975) Human Recombinant Protein
CAT#: TP301085
Recombinant protein of human enolase 2 (gamma, neuronal) (ENO2), 20 µg
USD 447.00
USD 471.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201085 protein sequence
Red=Cloning site Green=Tags(s) MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE ARFAGHNFRNPSVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001966 |
Locus ID | 2026 |
UniProt ID | P09104, Q6FHV6 |
Cytogenetics | 12p13.31 |
Refseq Size | 2423 |
Refseq ORF | 1302 |
Synonyms | HEL-S-279; NSE |
Summary | This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008] |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400724 | ENO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400724 | Transient overexpression lysate of enolase 2 (gamma, neuronal) (ENO2) |
USD 436.00 |
|
PH301085 | ENO2 MS Standard C13 and N15-labeled recombinant protein (NP_001966) |
USD 3,255.00 |
|
TP762399 | Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Asn220-Val433, with N-terminal His tag, expressed in E.coli, 50ug |
USD 249.00 |
|
TP762452 | Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Val188-Glu293, with N-terminal His tag, expressed in E.coli, 50ug |
USD 226.00 |
{0} Product Review(s)
Be the first one to submit a review