NSE (ENO2) (NM_001975) Human Recombinant Protein

SKU
TP301085
Recombinant protein of human enolase 2 (gamma, neuronal) (ENO2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201085 protein sequence
Red=Cloning site Green=Tags(s)

MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN
STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN
SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE
GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY
QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV
TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001966
Locus ID 2026
UniProt ID P09104
Cytogenetics 12p13.31
RefSeq Size 2423
RefSeq ORF 1302
Synonyms HEL-S-279; NSE
Summary This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008]
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation
Write Your Own Review
You're reviewing:NSE (ENO2) (NM_001975) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301085 ENO2 MS Standard C13 and N15-labeled recombinant protein (NP_001966) 10 ug
$3,255.00
LC400724 ENO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400724 Transient overexpression lysate of enolase 2 (gamma, neuronal) (ENO2) 100 ug
$436.00
TP762399 Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Asn220-Val433, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00
TP762452 Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Val188-Glu293, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.