NSE (ENO2) (NM_001975) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201085] |
Predicted MW | 47.3 kDa |
Protein Sequence |
Protein Sequence
>RC201085 protein sequence
Red=Cloning site Green=Tags(s) MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE ARFAGHNFRNPSVL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001966 |
RefSeq Size | 2423 |
RefSeq ORF | 1302 |
Synonyms | HEL-S-279; NSE |
Locus ID | 2026 |
UniProt ID | P09104 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008] |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400724 | ENO2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400724 | Transient overexpression lysate of enolase 2 (gamma, neuronal) (ENO2) | 100 ug |
$436.00
|
|
TP301085 | Recombinant protein of human enolase 2 (gamma, neuronal) (ENO2), 20 µg | 20 ug |
$737.00
|
|
TP762399 | Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Asn220-Val433, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
TP762452 | Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Val188-Glu293, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$226.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.