OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NSE (ENO2) (NM_001975) Human Mass Spec Standard

Be the first to review this product
SKU
PH301085
ENO2 MS Standard C13 and N15-labeled recombinant protein (NP_001966)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA813801 NSE mouse monoclonal antibody, clone OTI3C1 100 ul
$447.00
LY400724 Transient overexpression lysate of enolase 2 (gamma, neuronal) (ENO2) (as WB positive control) 100 ug
$436.00

Other products for "NSE or NM_001975"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201085
Predicted MW 47.3 kDa
Protein Sequence
Protein Sequence
>RC201085 protein sequence
Red=Cloning site Green=Tags(s)

MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN
STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN
SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE
GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY
QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV
TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001966
RefSeq Size 2423
RefSeq ORF 1302
Synonyms HEL-S-279; NSE
Locus ID 2026
UniProt ID P09104
Cytogenetics 12p13.31
Summary This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. provided by RefSeq, Jul 2008
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NSE" proteins (5)
SKU Description Size Price
LC400724 Lyophilized ENO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400724 Transient overexpression lysate of enolase 2 (gamma, neuronal) (ENO2) (as WB positive control) 100 ug
$436.00
TP301085 Recombinant protein of human enolase 2 (gamma, neuronal) (ENO2), 20 µg 20 ug
$737.00
TP762399 Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Asn220-Val433, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00
TP762452 Purified recombinant protein of Human enolase 2 (gamma, neuronal) (ENO2), Val188-Glu293, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products