PDCL3 (NM_024065) Human Recombinant Protein

SKU
TP300958
Recombinant protein of human phosducin-like 3 (PDCL3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200958 protein sequence
Red=Cloning site Green=Tags(s)

MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERA
IEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARK
FPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEE
NPKKPIEDVLLSSVRRSVLMKRDSDSEGD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076970
Locus ID 79031
UniProt ID Q9H2J4
Cytogenetics 2q11.2
RefSeq Size 1086
RefSeq ORF 717
Synonyms HTPHLP; PHLP2A; PHLP3; VIAF; VIAF1
Summary This gene encodes a member of the phosducin-like protein family and is a putative modulator of heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin. Members of the phosducin-like protein family have been shown to bind to the beta-gamma subunits of G proteins. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PDCL3 (NM_024065) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300958 PDCL3 MS Standard C13 and N15-labeled recombinant protein (NP_076970) 10 ug
$3,255.00
LC411381 PDCL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411381 Transient overexpression lysate of phosducin-like 3 (PDCL3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.