Cytochrome C Oxidase subunit VIb (COX6B1) (NM_001863) Human Recombinant Protein
SKU
TP300957
Recombinant protein of human cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) (COX6B1), nuclear gene encoding mitochondrial protein, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC200957 protein sequence
Red=Cloning site Green=Tags(s) MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWV TDWDEQRAEGTFPGKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001854 |
Locus ID | 1340 |
UniProt ID | P14854 |
Cytogenetics | 19q13.12 |
RefSeq Size | 590 |
RefSeq ORF | 258 |
Synonyms | COX6B; COXG; COXVIb1; MC4DN7 |
Summary | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq, Jan 2010] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300957 | COX6B1 MS Standard C13 and N15-labeled recombinant protein (NP_001854) | 10 ug |
$3,255.00
|
|
LC419691 | COX6B1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419691 | Transient overexpression lysate of cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) (COX6B1), nuclear gene encoding mitochondrial protein | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.