PRAS40 (AKT1S1) (NM_032375) Human Recombinant Protein

SKU
TP300919L
Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1, 1 mg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$7,820.00
6 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200919 representing NM_032375
Red=Cloning site Green=Tags(s)

MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYPAHGRGALAEAARRCLHDIALAHR
AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL
PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP
SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115751
Locus ID 84335
UniProt ID Q96B36
Cytogenetics 19q13.33
RefSeq Size 2344
RefSeq ORF 768
Synonyms Lobe; PRAS40
Summary AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:PRAS40 (AKT1S1) (NM_032375) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.