RUNX1T1 (NM_175636) Human Recombinant Protein

SKU
TP300898
Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200898 protein sequence
Red=Cloning site Green=Tags(s)

MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSS
SLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPL
RPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDR
TKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRH
PSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE
ELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVK
RQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCS
GCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPS
TIETTPR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 63 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_783554
Locus ID 862
UniProt ID Q06455
Cytogenetics 8q21.3
RefSeq Size 7319
RefSeq ORF 1701
Synonyms AML1-MTG8; AML1T1; CBFA2T1; CDR; ETO; MTG8; ZMYND2
Summary This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
Protein Families Transcription Factors
Protein Pathways Acute myeloid leukemia, Pathways in cancer
Write Your Own Review
You're reviewing:RUNX1T1 (NM_175636) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300898 RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783554) 10 ug
$3,255.00
PH322426 RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783553) 10 ug
$3,255.00
LC403575 RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406255 RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406277 RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430432 RUNX1T1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403575 Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 3 100 ug
$436.00
LY406255 Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4 100 ug
$436.00
LY406277 Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 2 100 ug
$665.00
LY430432 Transient overexpression lysate of runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 2 100 ug
$436.00
TP322426 Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.