POLR2F (NM_021974) Human Recombinant Protein

SKU
TP300855
Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200855 protein sequence
Red=Cloning site Green=Tags(s)

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRA
LQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_068809
Locus ID 5435
UniProt ID P61218
Cytogenetics 22q13.1
RefSeq Size 2109
RefSeq ORF 381
Synonyms HRBP14.4; POLRF; RPABC2; RPABC14.4; RPB6; RPB14.4; RPC15
Summary This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Protein Families Transcription Factors
Protein Pathways Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Write Your Own Review
You're reviewing:POLR2F (NM_021974) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300855 POLR2F MS Standard C13 and N15-labeled recombinant protein (NP_068809) 10 ug
$3,255.00
LC411849 POLR2F HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411849 Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide F (POLR2F) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.