RRP8 (NM_015324) Human Recombinant Protein

SKU
TP300844
Recombinant protein of human ribosomal RNA processing 8, methyltransferase, homolog (yeast) (RRP8), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200844 protein sequence
Red=Cloning site Green=Tags(s)

MFEEPEWAEAAPVAAGLGPVISRPPPAASSQNKGSKRRQLLATLRALEAASLSQHPPSLCISDSEEEEEE
RKKKCPKKASFASASAEVGKKGKKKCQKQGPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHA
PINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQVPDQ
APAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLY
HRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQV
PLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLT
NSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYKRR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056139
Locus ID 23378
UniProt ID O43159
Cytogenetics 11p15.4
RefSeq Size 1762
RefSeq ORF 1368
Synonyms KIAA0409; NML
Summary Essential component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. In the complex, RRP8 binds to H3K9me2 and probably acts as a methyltransferase. Its substrates are however unknown.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RRP8 (NM_015324) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300844 RRP8 MS Standard C13 and N15-labeled recombinant protein (NP_056139) 10 ug
$3,255.00
LC414621 RRP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414621 Transient overexpression lysate of ribosomal RNA processing 8, methyltransferase, homolog (yeast) (RRP8) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.