RIBC2 (NM_015653) Human Recombinant Protein

SKU
TP300766
Recombinant protein of human RIB43A domain with coiled-coils 2 (RIBC2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200766 protein sequence
Red=Cloning site Green=Tags(s)

MRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDPLALKKDLPARQSDNDVRNTISGM
QKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKA
VCASVKDFNKSQAIESVERKKQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQ
EQLEQIRLVQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLSLAKE
QHLQKKYMNEVYTNQPTGDYFTQFNTGSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056468
Locus ID 26150
UniProt ID Q9H4K1
Cytogenetics 22q13.31
RefSeq Size 1405
RefSeq ORF 927
Synonyms C22orf11; TRIB
Write Your Own Review
You're reviewing:RIBC2 (NM_015653) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300766 RIBC2 MS Standard C13 and N15-labeled recombinant protein (NP_056468) 10 ug
$3,255.00
LC414414 RIBC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414414 Transient overexpression lysate of RIB43A domain with coiled-coils 2 (RIBC2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.