IKB alpha (NFKBIA) (NM_020529) Human Recombinant Protein

SKU
TP300711
Recombinant protein of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200711 representing NM_020529
Red=Cloning site Green=Tags(s)

MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQL
TEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELR
DFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVN
AQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQML
PESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065390
Locus ID 4792
UniProt ID P25963
Cytogenetics 14q13.2
RefSeq Size 1550
RefSeq ORF 951
Synonyms EDAID2; IKBA; MAD-3; NFKBI
Summary This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. [provided by RefSeq, Aug 2011]
Protein Families Druggable Genome
Protein Pathways Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:IKB alpha (NFKBIA) (NM_020529) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300711 NFKBIA MS Standard C13 and N15-labeled recombinant protein (NP_065390) 10 ug
$3,255.00
LC412432 NFKBIA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412432 Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.