Epoxide hydrolase (EPHX1) (NM_000120) Human Recombinant Protein

SKU
TP300621
Recombinant protein of human epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200621 protein sequence
Red=Cloning site Green=Tags(s)

MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF
RFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHT
PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYK
LMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVE
LLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS
LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL
ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 52.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000111
Locus ID 2052
UniProt ID P07099
Cytogenetics 1q42.12
RefSeq Size 1847
RefSeq ORF 1365
Synonyms EPHX; EPOX; HYL1; MEH
Summary Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2008]
Protein Families Druggable Genome, Protease
Protein Pathways Metabolism of xenobiotics by cytochrome P450
Write Your Own Review
You're reviewing:Epoxide hydrolase (EPHX1) (NM_000120) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300621 EPHX1 MS Standard C13 and N15-labeled recombinant protein (NP_000111) 10 ug
$3,255.00
PH327627 EPHX1 MS Standard C13 and N15-labeled recombinant protein (NP_001129490) 10 ug
$3,255.00
LC400042 EPHX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427767 EPHX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400042 Transient overexpression lysate of epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 1 100 ug
$436.00
LY427767 Transient overexpression lysate of epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 2 100 ug
$436.00
TP327627 Recombinant protein of human epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.