IFIT3 (NM_001549) Human Recombinant Protein

SKU
TP300610
Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200610 protein sequence
Red=Cloning site Green=Tags(s)

MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA
LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC
EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK
VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ
IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK
EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001540
Locus ID 3437
UniProt ID O14879
Cytogenetics 10q23.31
RefSeq Size 2578
RefSeq ORF 1470
Synonyms CIG-49; cig41; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G
Summary IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Enhances MAVS-mediated host antiviral responses by serving as an adapter bridging TBK1 to MAVS which leads to the activation of TBK1 and phosphorylation of IRF3 and phosphorylated IRF3 translocates into nucleus to promote antiviral gene transcription. Exihibits an antiproliferative activity via the up-regulation of cell cycle negative regulators CDKN1A/p21 and CDKN1B/p27. Normally, CDKN1B/p27 turnover is regulated by COPS5, which binds CDKN1B/p27 in the nucleus and exports it to the cytoplasm for ubiquitin-dependent degradation. IFIT3 sequesters COPS5 in the cytoplasm, thereby increasing nuclear CDKN1B/p27 protein levels. Upregulates CDKN1A/p21 by downregulating MYC, a repressor of CDKN1A/p21. Can negatively regulate the apoptotic effects of IFIT2.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:IFIT3 (NM_001549) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300610 IFIT3 MS Standard C13 and N15-labeled recombinant protein (NP_001540) 10 ug
$3,255.00
PH314701 IFIT3 MS Standard C13 and N15-labeled recombinant protein (NP_001026853) 10 ug
$3,255.00
LC400593 IFIT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421898 IFIT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400593 Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 1 100 ug
$436.00
LY421898 Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2 100 ug
$665.00
TP314701 Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.